PAM16 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PAM16 Polyclonal antibody, PBS Only (15321-1-PBS)

• 

  WB analysis of HepG2 using 15321-1-AP (same clone as 15321-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15321-1-AP (PAM16 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15321-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 15321-1-AP (same clone as 15321-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 15321-1-AP (PAM16 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15321-1-PBS in a different storage buffer formulation.

PAM16 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15321-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

MAGMAS, CGI-136, TIM16, Presequence translocated-associated motor subunit PAM16, Mitochondrial import inner membrane translocase subunit TIM16

---

Product Information

15321-1-PBS targets PAM16 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0970

  Product name: Recombinant human PAM16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-105 aa of BC005024

  Sequence: MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERP

• Full Name: mitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC005024
• Gene Symbol: PAM16
• Gene ID (NCBI): 51025
• RRID: AB_2878126
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3D7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PAM16, also named as Magmas, TIM16 and TIMM16, is regulates ATP-dependent protein translocation into the mitochondrial matrix. The MW of PAM16 is about 14-16 kDa in WB detection. PAM16 is a component of the PAM complex at least composed of a mitochondrial HSP70 protein, GRPEL1 or GRPEL2, TIMM44, TIMM16/PAM16 and TIMM14/DNAJC19.