CoraLite®594-conjugated PHGDH Monoclonal antibody

• 

  IF Staining of HeLa using CL594-67591

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite®594 PHGDH antibody (CL594-67591, Clone: 1E8B8 ) at dilution of 1:200.

PHGDH Monoclonal Antibody for IF/ICC

Cat No. CL594-67591

Clone No.1E8B8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

EC:1.1.1.37, D-3-phosphoglycerate dehydrogenase, 3-PGDH, 3PGDH, 3 PGDH

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67591 targets PHGDH in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6877

  Product name: Recombinant human PHGDH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 186-533 aa of BC000303

  Sequence: FGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF

• Full Name: phosphoglycerate dehydrogenase
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC000303
• Gene Symbol: PHGDH
• Gene ID (NCBI): 26227
• RRID: AB_2920161
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43175
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PHGDH(D-3-phosphoglycerate dehydrogenase) is also named as 3-PGDH, PGDH3 and belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. It catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor. 3-PGDH deficiency is a rare recessive inborn error in the biosynthesis of the amino acid L-serine characterized clinically by congenital microcephaly, psychomotor retardation, and intractable seizures(PMID:19235232 ).