Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated PIN1 Polyclonal antibody

PIN1 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-10495

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

EC:5.2.1.8, Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1, Peptidyl-prolyl cis-trans isomerase Pin1, Pin 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10495 targets PIN1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0767

Product name: Recombinant human PIN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-163 aa of BC002899

Sequence: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

Predict reactive species
Full Name peptidylprolyl cis/trans isomerase, NIMA-interacting 1
Calculated Molecular Weight 18 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC002899
Gene Symbol PIN1
Gene ID (NCBI) 5300
RRIDAB_3083881
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13526
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

• PIN1(Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1) is essential for mitosis progression in yeast cells and is hypothesized to perform the same role in mammalian cells. It might regulate cellular processes distinct from the cell cycle itself, such as terminal differentiation through a modulation of differentiation-specific gene expression(PMID:20801874). It colocalizes with NEK6 in the nucleus. Pin1 inhibition simultaneously blocks multiple cancer pathways, disrupts the desmoplastic and immunosuppressive TME, and upregulates PD-L1 and ENT1, rendering pancreatic ductal adenocarcinoma (PDAC) eradicable by immunochemotherapy (PMID: 34388391).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 PIN1 antibody CL488-10495Download protocol
IF protocol for CL Plus 488 PIN1 antibody CL488-10495Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...