CoraLite®594-conjugated PLCL2 Monoclonal antibody

PLCL2 Monoclonal Antibody for IF/ICC
Cat No. CL594-67471
Clone No.1C8A4

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat, Mouse, Pig

Applications

IF/ICC

FLJ13484, KIAA1092, Phospholipase C epsilon 2, Phospholipase C L2, phospholipase C like 2, PLC epsilon 2, PLC L(2), PLC L2, PLCE2, PLCL2

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67471 targets PLCL2 in IF/ICC applications and shows reactivity with Human, Rat, Mouse, Pig samples.

Tested Reactivity Human, Rat, Mouse, Pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11461

Product name: Recombinant human PLCL2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 653-1001 aa of BC036392

Sequence: VDPYVYVEIHGIPADCAEQRTKTVHQNGDAHIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPRKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAVSPRFLGPDNTPLVVLNLSEQYPTMELQGIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKANDETGE

Predict reactive species
Full Name phospholipase C-like 2
Calculated Molecular Weight 126 kDa
Observed Molecular Weight 126 kDa
GenBank Accession NumberBC036392
Gene Symbol PLCL2
Gene ID (NCBI) 23228
RRIDAB_2920142
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9UPR0
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PLCL2, a novel phospholipase C-like protein, is expressed in lymphocytes and platelets. The expression of PLCL2 is associated with the proliferation of mature B cells in the immune system. PLCL2 is a new susceptibility loci for myocardial infarction. It has been shown that PLCL2 plays a key role in the pathogenesis of atherosclerosis and systemic sclerosisit. There are three isoforms of PLCL2 protein and 67471-1-Ig antibody detects the 126 kDa band in SDS-PAGE. (PMID: 24916648, 25880423)

Protocols

Product Specific Protocols
IF protocol for CL594 PLCL2 antibody CL594-67471Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...