PLEK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PLEK2 Polyclonal antibody, PBS Only (11685-1-PBS)

• 

  WB analysis using 11685-1-AP (same clone as 11685-1-PBS)

  U2OS (positive), Jurkat, Ramos, and U-937 (negative) cells were subjected to SDS PAGE followed by western blot with 11685-1-AP (PLEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11685-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11685-1-AP (same clone as 11685-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11685-1-AP (PLEK2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11685-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Caco-2 using 11685-1-AP (same clone as 11685-1-PBS)

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 11685-1-AP (PLEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11685-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HT-29 using 11685-1-AP (same clone as 11685-1-PBS)

  IP result of anti-PLEK2 (IP:11685-1-AP, 4ug; Detection:11685-1-AP 1:1000) with HT-29 cells lysate 1760 ug. This data was developed using the same antibody clone with 11685-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 11685-1-AP (same clone as 11685-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11685-1-AP (PLEK2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11685-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 11685-1-AP (same clone as 11685-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11685-1-AP (PLEK2 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 11685-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 11685-1-AP (same clone as 11685-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11685-1-AP (PLEK2 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 11685-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HT-29 using 11685-1-AP (same clone as 11685-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HT-29 cells using PLEK2 antibody (11685-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11685-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HT-29 using 11685-1-AP (same clone as 11685-1-PBS)

  1X10^6 HT-29 cells were intracellularly stained with 0.4 ug Anti-Human PLEK2 (11685-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP, Clone: ) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 11685-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PLEK2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 11685-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

Pleckstrin 2, Pleckstrin-2

---

Product Information

11685-1-PBS targets PLEK2 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2297

  Product name: Recombinant human PLEK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 90-353 aa of BC001226

  Sequence: EERDAWAFEITGAIHAGQPGKVQQLHSLRNSFKLPPHISLHRIVDKMHDSNTGIRSSPNMEQGSTYKKTFLGSSLVDWLISNSFTASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISPKEEISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT

• Full Name: pleckstrin 2
• Calculated Molecular Weight: 353 aa, 40 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC001226
• Gene Symbol: PLEK2
• Gene ID (NCBI): 26499
• RRID: AB_2252364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYT0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PLEK2 belongs to the Pleckstrin homology domain family and is a 40-kDa protein containing the prototypic PH domains at its amino and carboxyl termini(PMID: 10419454). PLEK2 associates with membrane-bound phosphatidylinositols generated by phosphatidylinositol 3-kinase. PLEK2 interacts with the actin cytoskeleton to induce cell spreading.