PPDPF Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PPDPF Polyclonal antibody, PBS Only (19912-1-PBS)

• 

  WB analysis using 19912-1-AP (same clone as 19912-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19912-1-AP (PPDPF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19912-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 19912-1-AP (same clone as 19912-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 19912-1-AP (PPDPF antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19912-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 19912-1-AP (same clone as 19912-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 19912-1-AP (C20orf149 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19912-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 19912-1-AP (same clone as 19912-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas using 19912-1-AP (PPDPF antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 19912-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 19912-1-AP (same clone as 19912-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas using 19912-1-AP (PPDPF antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 19912-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 19912-1-AP (same clone as 19912-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using PPDPF antibody (19912-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 19912-1-PBS in a different storage buffer formulation.

PPDPF Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 19912-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

C20orf149, EXPDF

---

Product Information

19912-1-PBS targets PPDPF in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13740

  Product name: Recombinant human C20orf149 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-114 aa of BC002531

  Sequence: MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMATVLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS

• Full Name: chromosome 20 open reading frame 149
• Calculated Molecular Weight: 114 aa, 12 kDa
• Observed Molecular Weight: 10-12 kDa
• GenBank Accession Number: BC002531
• Gene Symbol: PPDPF
• Gene ID (NCBI): 79144
• RRID: AB_10642438
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3Y8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Pancreatic progenitor cell differentiation and proliferation factor (PPDPF), also known as C20orf149 and EXPDF, belongs to the PPDPF family. PPDPF is a key regulator for the development of exocrine pancreas. PPDPF is highly expressed in various cancers, including HCC, colorectal cancer, prostate cancer, etc (PMID: 34031390, 34975328, 37027301). PPDPF consists of 114 amino acids and the molecular weight is 12 kDa.