Use Able AI chat for product recommendations

PSIP1 Monoclonal antibody, PBS Only (Capture)

PSIP1 Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 67723-1-PBS
Clone No.1E9E7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

1E9E7, CLL associated antigen KW 7, CLL-associated antigen KW-7, DFS70, LEDGF

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67723-1-PBS targets PSIP1 as part of a matched antibody pair:

MP50375-1: 67723-1-PBS capture and 68941-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30562

Product name: Recombinant human PSIP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 104-325 aa of NM_021144

Sequence: ASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETE

Predict reactive species
Full Name PC4 and SFRS1 interacting protein 1
Calculated Molecular Weight 60 kDa
Observed Molecular Weight75 kDa
GenBank Accession NumberNM_021144
Gene Symbol PSIP1
Gene ID (NCBI) 11168
RRIDAB_3670379
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO75475
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PSIP1, also known as PC4 and SRSF1 Interacting Protein 1 or Lens Epithelium-Derived Growth Factor (LEDGF), is a transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. It also plays a role in lens epithelial cell gene regulation and stress responses. It is a chromatin-associated protein with histone chaperone activity, involved in transcriptional elongation. PSIP1 may act as an adapter to coordinate pre-mRNA splicing. PSIP1 encodes two protein isoforms with molecular masses of 52 and 75 kDa. p52 and p75 were identified as interacting with transcription factor PC4 and shown to act as transcriptional coactivators.

Loading...
||
New chat

Able

正在加载,请稍候...