CoraLite® Plus 488-conjugated PSMB10 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated PSMB10 Monoclonal antibody (CL488-66403)

• 

  IF Staining of Raji using CL488-66403

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using CoraLite® Plus 488 PSMB10 antibody (CL488-66403, Clone: 1G8C1 ) at dilution of 1:200, CL594-phalloidin (red).

PSMB10 Monoclonal Antibody for IF/ICC

Cat No. CL488-66403

Clone No.1G8C1

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

IF/ICC

Synonyms

1G8C1, EC:3.4.25.1, LMP10, Macropain subunit MECl-1, MECL1

---

Tested Applications

• Positive IF/ICC detected in: Raji cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66403 targets PSMB10 in IF/ICC applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8835

  Product name: Recombinant human PSMB10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-273 aa of BC017198

  Sequence: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE

• Full Name: proteasome (prosome, macropain) subunit, beta type, 10
• Calculated Molecular Weight: 273 aa, 29 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC017198
• Gene Symbol: PSMB10
• Gene ID (NCBI): 5699
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40306
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SMB10(Proteasome subunit beta type-10) is also named as LMP10, MECL1.It belongs to the peptidase T1B family and is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.