• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated PSMB2 Monoclonal antibody

PSMB2 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-68180
Clone No.3C5C5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

3C5C5, Macropain subunit C7-I, Multicatalytic endopeptidase complex subunit C7-I, Proteasome component C7-I, Proteasome subunit beta type-2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells, PC-3 cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68180 targets PSMB2 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7308

Product name: Recombinant human PSMB2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-201 aa of BC000268

Sequence: MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS

Predict reactive species
Full Name proteasome (prosome, macropain) subunit, beta type, 2
Calculated Molecular Weight 23 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC000268
Gene Symbol PSMB2
Gene ID (NCBI) 5690
RRIDAB_3084433
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP49721
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PSMB2(proteasome subunit beta type-2) is also named as macropain subunit C7-I, proteasome component C7-I, multicatalytic endopeptidase complex subunit C7-I and belongs to the peptidase T1B family. It is involved in an ATP/ubiquitin-dependent non-lysosomal proteolytic pathway. The up-regulation of PSMB2 may indicate the activated neuronal defensive mechanism in VAD(vitamin A depletion) brain regions, which may underlie the VAD-related psychosis behavior(PMID:21190828).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PSMB2 antibody CL488-68180Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...