Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated PSMD9 Polyclonal antibody

PSMD9 Polyclonal Antibody for FC (Intra)

Cat No. CL488-26922

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

FC (Intra)

26S proteasome non-ATPase regulatory subunit 9, p27, Rpn4

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-26922 targets PSMD9 in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25638

Product name: Recombinant human PSMD9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-102 aa of BC004213

Sequence: MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHA

Predict reactive species
Full Name proteasome (prosome, macropain) 26S subunit, non-ATPase, 9
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC004213
Gene Symbol PSMD9
Gene ID (NCBI) 5715
RRIDAB_3672806
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00233
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PSMD9 is a ubiquitous protein of eukaryotic cells and is a chaperon of the 26S proteasome complex, which degrades ubiquitinated proteins in eukaryotic cells and contributes to the degradation of intracellular proteins into antigenic peptides for antigen presentation by MHC class I cells. The 26S mammalian base sub-complex involves three distinct modules which have ATPase subunits distinctly associated to three chaperones, one of which is PSMD9 regulating the modules assembly. The PSMD9 ubiquitous regulatory role within the proteasome implies its potential pleiotropic effects within different physio-pathological systems. PSMD9 is known to form a stable subcomplex with PSMC3 and PSMC6, two of the AAA-ATPases, assisting in the assembly of the 20S and 19S particles to form the holo complex.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 PSMD9 antibody CL488-26922Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...