PTGER4 Monoclonal antibody, PBS Only

• 

  WB analysis of pig brain using 66921-1-Ig (same clone as 66921-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 66921-1-Ig (PTGER4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66921-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 66921-1-Ig (same clone as 66921-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 66921-1-Ig (PTGER4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66921-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 66921-1-Ig (same clone as 66921-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66921-1-Ig (PTGER4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66921-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66921-1-Ig (same clone as 66921-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66921-1-Ig (PTGER4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66921-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 66921-1-Ig (same clone as 66921-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 66921-1-Ig (PTGER4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66921-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate hyperplasia using 66921-1-Ig (same clone as 66921-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 66921-1-Ig (PTGER4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66921-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate hyperplasia using 66921-1-Ig (same clone as 66921-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 66921-1-Ig (PTGER4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66921-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66921-1-Ig (same clone as 66921-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66921-1-Ig (PTGER4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66921-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66921-1-Ig (same clone as 66921-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66921-1-Ig (PTGER4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66921-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 66921-1-Ig (same clone as 66921-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using PTGER4 antibody (66921-1-Ig, Clone: 4A2A12 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66921-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 66921-1-Ig (same clone as 66921-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using PTGER4 antibody (66921-1-Ig, Clone: 4A2A12 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66921-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 66921-1-Ig (same clone as 66921-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human PTGER4 (66921-1-Ig, Clone:4A2A12) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2b Isotype Control (MPC-11) (65128-1-Ig, Clone: MPC-11) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 66921-1-PBS in a different storage buffer formulation.

PTGER4 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), Indirect ELISA

Cat No. 66921-1-PBS

Clone No.4A2A12

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, FC (Intra), Indirect ELISA

Synonyms

4A2A12, EP4, EP4R

---

Product Information

66921-1-PBS targets PTGER4 in WB, IHC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19262

  Product name: Recombinant human PTGER4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 333-488 aa of BC101534

  Sequence: RKTVLSKAIEKIKCLFCRIGGSRRERSGQHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI

• Full Name: prostaglandin E receptor 4 (subtype EP4)
• Calculated Molecular Weight: 488 aa, 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC101534
• Gene Symbol: PTGER4
• Gene ID (NCBI): 5734
• RRID: AB_2882248
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35408
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PTGER4 (Prostaglandin E2 receptor EP4 subtype, also known as EP4R) is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.