Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated PTGER4 Monoclonal antibody

PTGER4 Monoclonal Antibody for FC (Intra)

Cat No. CL488-66921
Clone No.4A2A12

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

FC (Intra)

4A2A12, EP4, EP4R

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66921 targets PTGER4 in FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19262

Product name: Recombinant human PTGER4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 333-488 aa of BC101534

Sequence: RKTVLSKAIEKIKCLFCRIGGSRRERSGQHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI

Predict reactive species
Full Name prostaglandin E receptor 4 (subtype EP4)
Calculated Molecular Weight 488 aa, 53 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC101534
Gene Symbol PTGER4
Gene ID (NCBI) 5734
RRIDAB_3084288
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35408
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PTGER4 (Prostaglandin E2 receptor EP4 subtype, also known as EP4R) is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 PTGER4 antibody CL488-66921Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...