CoraLite® Plus 488-conjugated PTGES3 Monoclonal antibody

PTGES3 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67736
Clone No.3C11D11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF/ICC, FC (Intra)

P23, Hsp90 co-chaperone, Hsp90 co chaperone, EC:5.3.99.3, cPGES

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67736 targets PTGES3 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7870

Product name: Recombinant human PTGES3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-160 aa of BC003005

Sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Predict reactive species
Full Name prostaglandin E synthase 3 (cytosolic)
Calculated Molecular Weight 19 kDa
Observed Molecular Weight22 kDa
GenBank Accession NumberBC003005
Gene Symbol PTGES3
Gene ID (NCBI) 10728
RRIDAB_2923784
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15185
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

P23, encoded by the gene PTGES3, plays a key role in glucocorticoid signaling and was increased at the mRNA level in the DLPFC in individuals with schizophrenia (PMID: 24345775). In the GR heterocomplex in vitro, p23 is an obligatory co-factor19 and is the limiting component of the complex44, functioning to stabilize the interaction of the complex with GR in the cytoplasm. Paradoxically, p23 also acts in the nucleus to inhibit GR-mediated gene transcription and disassemble GR transcriptional machinery in the nucleus (PMID: 12077419). In vivo, p23 is critical for appropriate glucocorticoid responsiveness (PMID: 17000766).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PTGES3 antibody CL488-67736Download protocol
FC protocol for CL Plus 488 PTGES3 antibody CL488-67736Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...