CoraLite® Plus 594-conjugated Podoplanin Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 594-conjugated Podoplanin Recombinant monoclonal antibody (CL594-86750-2)

Podoplanin Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL594-86750-2 Copied!

Clone No. 251406B11

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF-P

Synonyms

PDPN, 29kDa cytosolic podoplanin intracellular domain, Aggrus, PA2.26 antigen, PSEC0003

• 

  IF Staining of human placenta using CL594-86750-2

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using CoraLite® Plus 594 Podoplanin antibody (CL594-86750-2, Clone: 251406B11 ) at dilution of 1:100. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human placenta using CL594-86750-2

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using CoraLite® Plus 594 Podoplanin antibody (CL594-86750-2, Clone: 251406B11 ) at dilution of 1:100. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Podoplanin in ?

Chat with Able

---

Tested Applications

• Positive IF-P detected in: human placenta tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-86750-2 targets Podoplanin in IF-P applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5024

  Product name: Recombinant Human Podoplanin protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 23-131 aa of BC014668

  Sequence: ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTL

• Full Name: podoplanin
• Observed Molecular Weight: 36-43 kDa
• GenBank Accession Number: BC014668
• Gene Symbol: Podoplanin
• Gene ID (NCBI): 10630
• Conjugate: CoraLite® Plus 594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Excitation Laser: Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86YL7-1
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Podoplanin was identified as a 43 kDa glycoprotein found in the cell membranes of glomerular epithelial cells (podocyte) (PMID: 9327748). It is a lymphatic marker because the expression of podoplanin has been detected in lymphatic but not blood vascular endothelium, and is useful as the marker of tumor-associated Lymphangiogenesis. Podoplanin has a function in developing testis, most likely at the level of cell-cell interactions among pre-meiotic germ cells and immature Sertoli cells. It may be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, PDPN induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It is required for normal lung cell proliferation and alveolus formation at birth. PDPN induces platelet aggregation. It does not have any effect on folic acid or amino acid transport and does not function as a water channel or as a regulator of aquaporin-type water channels.