• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated RAB32 Recombinant monoclonal antibody

RAB32 Uni-rAb® Recombinant Antibody for WB, FC (Intra)
Cat No. CL488-82960
Clone No.230315A9

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, FC (Intra)

230315A9, Ras related protein Rab 32, Ras-related protein Rab-32

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82960 targets RAB32 in WB, FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1450

Product name: Recombinant human RAB32 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-225 aa of BC015061

Sequence: MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC

Predict reactive species
Full Name RAB32, member RAS oncogene family
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 25-28 kDa
GenBank Accession NumberBC015061
Gene Symbol RAB32
Gene ID (NCBI) 10981
RRIDAB_3673152
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13637
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Rab32 belongs to the Ras-like small GTPase superfamily, which regulate membrane dynamics, including membrane fusion/fission, exocytosis, and cytoskeletal trafficking. Rab32 anchors the type II regulatory subunit of protein kinase A to the mitochondrion and aids in mitochondrial fission. TRab32 also appears to be involved in autophagy and melanosome secretion.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 RAB32 antibody CL488-82960Download protocol
WB protocol for CL Plus 488 RAB32 antibody CL488-82960Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...