CoraLite® Plus 488-conjugated RAB39B Monoclonal antibody

RAB39B Monoclonal Antibody for FC (Intra)
Cat No. CL488-68014
Clone No.2F4F7

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit

Applications

FC (Intra)

2F4F7, Ras related protein Rab 39B, Ras-related protein Rab-39B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68014 targets RAB39B in FC (Intra) applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27170

Product name: Recombinant human RAB39B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-213 aa of BC009714

Sequence: MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC

Predict reactive species
Full Name RAB39B, member RAS oncogene family
Calculated Molecular Weight 213 aa, 25 kDa
Observed Molecular Weight25 kDa
GenBank Accession NumberBC009714
Gene Symbol RAB39B
Gene ID (NCBI) 116442
RRIDAB_2923859
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96DA2
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RAB39B is a member of the RAB GTPase family with a putative role in vesicle trafficking. RAB39B is predominantly expressed in neuronal cells and is localized to the endoplasmic reticulum, Golgi and trans‐Golgi recycling endosomes. Several reports suggested that RAB39B may regulate protein trafficking and the PI3K-AKT-mTOR pathway. Mutations in RAB39B are known to be associated with X-linked intellectual disability (XLID), Parkinson's disease, and autism.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 RAB39B antibody CL488-68014Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...