• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated RAB3IP/Rabin8 Polyclonal antibody

RAB3IP/Rabin8 Polyclonal Antibody for IF/ICC
Cat No. CL594-12321

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

FLJ14660, FLJ22548, Rab 3A interacting protein, Rab3A interacting protein, RAB3IP, Rabin 3, RABIN3, rabin8, SSX2 interacting protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-12321 targets RAB3IP/Rabin8 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2974

Product name: Recombinant human RABIN8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 21-254 aa of BC015548

Sequence: GKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFKKGHTRNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL

Predict reactive species
Full Name RAB3A interacting protein (rabin3)
Calculated Molecular Weight 476 aa, 53 kDa
Observed Molecular Weight 56 kDa
GenBank Accession NumberBC015548
Gene Symbol RAB3IP
Gene ID (NCBI) 117177
RRIDAB_2919782
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96QF0
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RAB3IP, also hnown as Rabin8, is a deduced 476-amino acid protein containing a central coiled-coil domain, a bipartite nuclear localization signal, and a C-terminal endoplasmic reticulum retention motif. Rabin8 has several sites for N-glycosylation and phosphorylation. Rabin8 plays important roles in various cellular processes, including ciliogenesis.The GEF activity of Rabin8 towards Rab8 is essential for ciliogenesis and cyst apical membrane transport,but not for exocytosis of discoidal/fusiform-shaped vesicles.

Protocols

Product Specific Protocols
IF protocol for CL594 RAB3IP/Rabin8 antibody CL594-12321Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...