• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated RB1CC1 Polyclonal antibody

RB1CC1 Polyclonal Antibody for WB
Cat No. CL488-17250

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB

RBICC, RB1-inducible coiled-coil protein 1, RB1CC 1, KIAA0203, FAK family kinase-interacting protein of 200 kDa

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, K-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17250 targets RB1CC1 in WB applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10508

Product name: Recombinant human RB1CC1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1241-1594 aa of BC017556

Sequence: AIQTALKEFKLEREVVEKELLEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV

Predict reactive species
Full Name RB1-inducible coiled-coil 1
Calculated Molecular Weight 1594 aa, 183 kDa
Observed Molecular Weight 200 kDa
GenBank Accession NumberBC017556
Gene Symbol RB1CC1
Gene ID (NCBI) 9821
RRIDAB_3084001
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8TDY2
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RB1CC1, also named as RBICC or FIP200, is implicated in the regulation of RB1 expression and functions as a DNA-binding transcription factor. It is a potent regulator of the RB1 pathway and a mediator that plays a crucial role in muscular differentiation. Its expression is, thus, a prerequisite for myogenic differentiation. Involved in autophagy. RB1CC1 is required for autophagosome formation. It is probably involved in the tumorigenesis of breast cancer. RB1CC1 is frequently mutated in breast cancer and shows characteristics of a classical tumor suppressor gene. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human RB1CC1. the calculated molecular weight of RB1CC1 is 180 kDa, but the modified RB1CC1 is about 200 kDa.

Protocols

Product Specific Protocols
WB protocol for CL Plus 488 RB1CC1 antibody CL488-17250Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...