• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated RGS5 Polyclonal antibody

RGS5 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-11590

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Regulator of G-protein signaling 5

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHT-1080 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11590 targets RGS5 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2196

Product name: Recombinant human RGS5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-181 aa of BC030059

Sequence: MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Predict reactive species
Full Name regulator of G-protein signaling 5
Calculated Molecular Weight 181 aa, 21 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC030059
Gene Symbol RGS5
Gene ID (NCBI) 8490
RRIDAB_3083906
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15539
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RGS5 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. It binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha. The 42kd band recognized by this antibody is a RGS5-RGS5 dimer. (Pubmed:17762159)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RGS5 antibody CL488-11590Download protocol
FC protocol for CL Plus 488 RGS5 antibody CL488-11590Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...