RNF145 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RNF145 Polyclonal antibody, PBS Only (24524-1-PBS)

• 

  WB analysis using 24524-1-AP (same clone as 24524-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24524-1-AP (RNF145 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24524-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24524-1-AP (same clone as 24524-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24524-1-AP (RNF145 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24524-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 24524-1-AP (same clone as 24524-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24524-1-AP (RNF145 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24524-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 24524-1-AP (same clone as 24524-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24524-1-AP (RNF145 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24524-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RNF145 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24524-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:2.3.2.27, RING finger protein 145

---

Product Information

24524-1-PBS targets RNF145 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21463

  Product name: Recombinant human RNF145 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 492-663 aa of BC042684

  Sequence: IHSYYNVWLRAQLGWKSFLLRRDAVNKIKSLPIATKEQLEKHNDICAICYQDMKSAVITPCSHFFHAGCLKKWLYVQETCPLCHCHLKNSSQLPGLGTEPVLQPHAGAEQNVMFQEGTEPPGQEHTPGTRIQEGSRDNNEYIARRPDNQEGAFDPKEYPHSAKDEVHPVESA

• Full Name: ring finger protein 145
• Calculated Molecular Weight: 663 aa, 76 kDa
• Observed Molecular Weight: 76-79 kDa
• GenBank Accession Number: BC042684
• Gene Symbol: RNF145
• Gene ID (NCBI): 153830
• RRID: AB_2879589
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MT1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.