RNF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RNF2 Polyclonal antibody, PBS Only (16031-1-PBS)

• 

  WB analysis of K-562 using 16031-1-AP (same clone as 16031-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 16031-1-AP (RNF2 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16031-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 16031-1-AP (same clone as 16031-1-PBS)

  WB result of RNF2 antibody (16031-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RNF2 transfected HEK-293 cells. This data was developed using the same antibody clone with 16031-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 16031-1-AP (same clone as 16031-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 16031-1-AP (RNF2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16031-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 16031-1-AP (same clone as 16031-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 16031-1-AP (RNF2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16031-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 16031-1-AP (same clone as 16031-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 16031-1-AP (RNF2 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16031-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 16031-1-AP (same clone as 16031-1-PBS)

  IP result of anti-RNF2 (IP:16031-1-AP, 4ug; Detection:16031-1-AP 1:800) with K-562 cells lysate 1200ug. This data was developed using the same antibody clone with 16031-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 16031-1-AP (same clone as 16031-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 16031-1-AP (RNF2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16031-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RNF2 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 16031-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

HIP2 interacting protein 3, EC:2.3.2.27, E3 ubiquitin-protein ligase RING2, DING, BAP1

---

Product Information

16031-1-PBS targets RNF2 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8900

  Product name: Recombinant human RNF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-336 aa of BC012583

  Sequence: MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK

• Full Name: ring finger protein 2
• Calculated Molecular Weight: 336 aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC012583
• Gene Symbol: RNF2
• Gene ID (NCBI): 6045
• RRID: AB_2180459
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99496
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RNF2 (also known as ding, Ring1B or Ring2) is a member of the Ring finger protein family, which functions as E3 ubiquitin ligase for monoubiquitination of histone H2A at lysine 119 (H2AK119ub). Many studies have demonstrated that overexpressed RNF2 was involved in the pathological progression of multiple cancers and has an impact on their clinical features. For instance, the upregulated expression level of RNF2 is positively correlated with the occurrence and progression of hepatocellular carcinoma, melanoma, prostate cancer, breast cancer, pancreatic cancer, gastric cancer, and bladder urothelial carcinoma, as well as with the radioresistance of lung cancer and chemoresistance of ovarian cancer (PMID: 33400276). The molecular weight of RNF2 is 38 kDa.