RYR1 Monoclonal antibody

• 

  IHC staining of mouse skeletal muscle using 66539-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 66539-1-Ig (RYR1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 66539-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 66539-1-Ig (RYR1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 66539-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66539-1-Ig (RYR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A-673 using 66539-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A-673 cells using RYR1 antibody (66539-1-Ig, Clone: 1B4E12 ) at dilution of 1:300 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ).

RYR1 Monoclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 66539-1-Ig

Clone No.1B4E12

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

1B4E12, CCO, Ryanodine receptor 1, RYDR, RYR1/2/3

---

Tested Applications

• Positive IHC detected in: mouse skeletal muscle tissue, mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A-673 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

66539-1-Ig targets RYR1 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25120

  Product name: Recombinant human RYR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4942-5038 aa of NM_000540

  Sequence: GELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS

• Full Name: ryanodine receptor 1 (skeletal)
• Calculated Molecular Weight: 565 kDa
• GenBank Accession Number: NM_000540
• Gene Symbol: RYR1
• Gene ID (NCBI): 6261
• RRID: AB_2881901
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P21817
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ryanodine receptor isoform-1 (RyR1) is a major calcium channel in skeletal muscle important for excitation-contraction coupling. The transmembrane region of RyR1 is comprised of two domains including the pseudo voltage sensor domain and the pore-forming domain (PMID: 27855725). Dominant RyR1 mutations are the leading cause of MH. Studies on the Ca2+ conducting properties of RyR1 channels containing Malignant hyperthermia mutations expressed in myotubes.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Cell Rep; Region-resolved multi-omics of the mouse eye; Authors - Hang Xiang