CoraLite® Plus 488-conjugated RanBP1 Polyclonal antibody

RanBP1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-27804

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

RAN binding protein 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inNIH/3T3 cells, HeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27804 targets RanBP1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25714

Product name: Recombinant human RANBP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-60 aa of

Sequence: MLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQ

Predict reactive species
Full Name RAN binding protein 1
Observed Molecular Weight 28 kDa
Gene Symbol RANBP1
Gene ID (NCBI) 5902
RRIDAB_3672818
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP43487
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RanBP1 (Ran-binding protein 1) belongs to the RANBP1 family. RanBP1 plays a role in RAN-dependent nucleocytoplasmic transport. It alleviates the TNPO1-dependent inhibition of RAN GTPase activity and mediates the dissociation of RAN from proteins involved in transport into the nucleus. And RanBP1 induces a conformation change in the complex formed by XPO1 and RAN that triggers the release of the nuclear export signal of cargo proteins (PMID:20485264). RanBP1 promotes dissociation of RAN from a complex with KPNA2 and CSE1L. It required for normal mitotic spindle assembly and normal progress through mitosis via its effect on RAN (PMID:17671426). Also, RanBP1 inhibits RCC1-dependent exchange of RAN-bound GDP by GTP (PMID:7882974, PMID:7616957).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 RanBP1 antibody CL488-27804Download protocol
IF protocol for CL Plus 488 RanBP1 antibody CL488-27804Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...