SCUBE3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SCUBE3 Polyclonal antibody, PBS Only (16773-1-PBS)

• 

  WB analysis using 16773-1-AP (same clone as 16773-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16773-1-AP (SCUBE3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16773-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 16773-1-AP (same clone as 16773-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 16773-1-AP (SCUBE3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16773-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 16773-1-AP (same clone as 16773-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 16773-1-AP (SCUBE3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16773-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SCUBE3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16773-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CEGF3, Signal peptide, CUB and EGF-like domain-containing protein 3

---

Product Information

16773-1-PBS targets SCUBE3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10085

  Product name: Recombinant human SCUBE3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 643-992 aa of BC052263

  Sequence: YYHGQTEQCVPCPAGTFQEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCPPGQHSVDGFKPCQPCPRGTYQPEAGRTLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIHRCIRCAMGSYQPDFRQNFCSRCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQNYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK

• Full Name: signal peptide, CUB domain, EGF-like 3
• Calculated Molecular Weight: 992 aa, 109 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC052263
• Gene Symbol: SCUBE3
• Gene ID (NCBI): 222663
• RRID: AB_2285430
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IX30
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SCUBE3 is a secreted glycoprotein that belongs to the SCUBE family. Members of the SCUBE family are secreted plasma membrane-associated proteins characterised by a N-terminal signal peptide sequence, multiple EGF domains, a N-linked glycosylated spacer region and a C-terminal CUB region. SCUBE3 may play a role in bone cell biology (PMID: 15234972). It may also has a role in the regulation of cardiac growth and remodeling responses (PMID: 17442284). Besides, SCUBE3 has been reported to be involved in lung cancer progression (PMID: 21441952; 23420440).