SEC22B Recombinant monoclonal antibody

• 

  WB analysis using 85037-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85037-5-RR (SEC22B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 85037-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 85037-5-RR (SEC22B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 85037-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 85037-5-RR (SEC22B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 85037-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85037-5-RR (SEC22B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 85037-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85037-5-RR (SEC22B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of SH-SY5Y using 85037-5-RR

  1x10^6 SH-SY5Y cells were intracellularly stained with 0.25 ug SEC22B Recombinant antibody (85037-5-RR, Clone:242659B3) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 85037-5-RR

  Biolayer interferometry (BLl) kinetic assays of 85037-5-RR against Human SEC22B were performed. The affinity constant is 2.07 nM.

SEC22B Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 85037-5-RR

Clone No.242659B3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, hamster

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

242659B3, ER-Golgi SNARE of 24 kDa, ERS24, ERS-24, SEC22 vesicle-trafficking protein homolog B

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, CHO cells, mouse brain tissue, rat brain tissue, fetal human brain tissue, human placenta tissue
• Positive IHC detected in: mouse liver tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85037-5-RR targets SEC22B in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, hamster samples.

• Tested Reactivity: human, mouse, rat, hamster
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12981

  Product name: Recombinant human SEC22B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-215 aa of BC001364

  Sequence: VLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL

• Full Name: SEC22 vesicle trafficking protein homolog B (S. cerevisiae)
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC001364
• Gene Symbol: SEC22B
• Gene ID (NCBI): 9554
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75396
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Soluble N-ethylmaleimide-sensitive factor (NSF) attachment protein receptor (SNARE) proteins are critical components of the membrane fusion machinery (PMID: 20163564). SEC22B is a SNARE involved in endoplasmic reticulum (ER)/Golgi membrane trafficking. SEC22B localizes to the ER-Golgi intermediate compartment (ERGIC) and has been identified as a regulator of antigen crosspresentation (PMID: 22153078).