Home
Products
Primary Antibodies
SGCG Polyclonal antibody, PBS Only (18102-1-PBS)

Filter: AllWBIPIHC

WB analysis of human skeletal muscle using 18102-1-AP (same clone as 18102-1-PBS)
human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 18102-1-AP (SGCG antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
WB analysis using 18102-1-AP (same clone as 18102-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 18102-1-AP (SGCG antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
WB analysis of human heart using 18102-1-AP (same clone as 18102-1-PBS)
human heart tissue were subjected to SDS PAGE followed by western blot with 18102-1-AP (SGCG antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
WB analysis of mouse heart using 18102-1-AP (same clone as 18102-1-PBS)
mouse heart tissue were subjected to SDS PAGE followed by western blot with 18102-1-AP (SGCG Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
IP experiment of mouse heart using 18102-1-AP (same clone as 18102-1-PBS)
IP result of anti-SGCG (IP:18102-1-AP, 4ug; Detection:18102-1-AP 1:1000) with mouse heart tissue lysate 4000ug. This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 18102-1-AP (same clone as 18102-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 18102-1-AP (same clone as 18102-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 18102-1-AP (same clone as 18102-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 18102-1-AP (same clone as 18102-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 18102-1-AP (same clone as 18102-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 18102-1-AP (same clone as 18102-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 18102-1-AP (same clone as 18102-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 18102-1-AP (same clone as 18102-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
IHC staining of human lung using 18102-1-AP (same clone as 18102-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
IHC staining of human lung using 18102-1-AP (same clone as 18102-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
IHC staining of human ovary using 18102-1-AP (same clone as 18102-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.
IHC staining of human ovary using 18102-1-AP (same clone as 18102-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary using 18102-1-AP (SGCG antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18102-1-PBS in a different storage buffer formulation.

SGCG Polyclonal antibody, PBS Only

Name: SGCG Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 18102-1-PBS

SGCG Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 18102-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

35 kDa dystrophin-associated glycoprotein, Gamma sarcoglycan, Gamma-sarcoglycan, Gamma-SG

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

18102-1-PBS targets SGCG in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12402 Product name: Recombinant human SGCG protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-291 aa of BC074777 Sequence: MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHICL Predict reactive species
Full Name	sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)
Calculated Molecular Weight	291 aa, 32 kDa
Observed Molecular Weight	35-38 kDa
GenBank Accession Number	BC074777
Gene Symbol	SGCG
Gene ID (NCBI)	6445
RRID	AB_2286186
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q13326
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.