CoraLite® Plus 488-conjugated SLC25A1 Monoclonal antibody

• 

  WB analysis using CL488-66771

  Various lysates were subjected to SDS PAGE followed by western blot with CL488-66771 (SLC25A1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

SLC25A1 Monoclonal Antibody for WB

Cat No. CL488-66771

Clone No.1F11A3

Host / Isotype

Mouse / IgG3

Reactivity

human, mouse, rat

Applications

WB

Synonyms

Tricarboxylate carrier protein, SLC20A3, CTP, Citrate transport protein, CIC

---

Tested Applications

• Positive WB detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66771 targets SLC25A1 in WB applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG3
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7520

  Product name: Recombinant human SLC25A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-311 aa of BC004980

  Sequence: MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD

• Full Name: solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC004980
• Gene Symbol: SLC25A1
• Gene ID (NCBI): 6576
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P53007
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SLC25A1, also known as CIC or CTP, is a mitochondrial citrate transporter that exports citrate from the mitochondria to the cytosol. SLC25A1 is highly expressed in several tumor types. Recently it has been identified as a novel transcriptional target of mutant p53 and a negative tumor prognostic marker. In addition, defects in SLC25A1 has been found as a cause of combined D-2- and L-2-hydroxyglutaric aciduria. This antibody specifically recognized the endogenous SLC25A1; no protein was detected in cells from subjects containing two alleles with truncating mutations with this antibody. (24681808, 23561848)