CoraLite® Plus 647-conjugated SMCR7L/MID51 Monoclonal antibody

SMCR7L/MID51 Monoclonal Antibody for IF-P
Cat No. CL647-67808
Clone No.3B3G3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF-P

SMCR7L, Smith-Magenis syndrome chromosomal region candidate gene 7 protein-like, SMCR7-like protein, MIEF1, MID51

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse testis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-67808 targets SMCR7L/MID51 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13775

Product name: Recombinant human SMCR7L protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-359 aa of BC002587

Sequence: FDTDTFCPPRPKPVARKGQVDLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQT

Predict reactive species
Full Name Smith-Magenis syndrome chromosome region, candidate 7-like
Calculated Molecular Weight 463 aa, 51 kDa
Observed Molecular Weight48-51 kDa
GenBank Accession NumberBC002587
Gene Symbol SMCR7L
Gene ID (NCBI) 54471
RRIDAB_2920313
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NQG6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Human SMCR7L gene encodes, MID51, the mitochondrial dynamic protein of 51 kDa (also called mitochondrial elongation factor 1, MIEF1). MID51 is a single-pass membrane protein anchored to the mitochondrial outer membrane and regulates mitochondrial morphology. Mitochondrial morphology is controlled by two opposing processes: fusion and fission. Elevated MID51 levels induce extensive mitochondrial fusion, whereas depletion of MID51 causes mitochondrial fragmentation. MID51 interacts with and recruits Drp1 to mitochondria, suggesting a critical role of MID51 in regulation of mitochondrial fusion-fission machinery in vertebrates.

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 SMCR7L/MID51 antibody CL647-67808Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...