SRXN1 Polyclonal antibody, PBS Only

• 

  WB analysis using 14273-1-AP (same clone as 14273-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14273-1-AP (SRX1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14273-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 14273-1-AP (same clone as 14273-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 14273-1-AP (SRX1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14273-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 14273-1-AP (same clone as 14273-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14273-1-AP (SRX1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14273-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Transfected HEK-293 using 14273-1-AP (same clone as 14273-1-PBS)

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 14273-1-AP (SRX1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14273-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A549 using 14273-1-AP (same clone as 14273-1-PBS)

  IP result of anti-SRX1 (IP:14273-1-AP, 3ug; Detection:14273-1-AP 1:400) with A549 cells lysate 3300ug. This data was developed using the same antibody clone with 14273-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 14273-1-AP (same clone as 14273-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14273-1-AP (SRX1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14273-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 14273-1-AP (same clone as 14273-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14273-1-AP (SRX1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14273-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14273-1-AP (same clone as 14273-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 14273-1-AP (SRX1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14273-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14273-1-AP (same clone as 14273-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 14273-1-AP (SRX1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14273-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 14273-1-AP (same clone as 14273-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14273-1-AP (SRX1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14273-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 14273-1-AP (same clone as 14273-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14273-1-AP (SRX1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14273-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SRXN1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 14273-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

C20orf139, EC:1.8.98.2, SRX, SRX1, Sulfiredoxin 1

---

Product Information

14273-1-PBS targets SRXN1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5613

  Product name: Recombinant human SRX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-137 aa of BC047707

  Sequence: MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ

• Full Name: sulfiredoxin 1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC047707
• Gene Symbol: SRXN1
• Gene ID (NCBI): 140809
• RRID: AB_2195030
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYN0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.