CoraLite®555-conjugated STAT4 Monoclonal antibody

• 

  IF Staining of HepG2 using CL555-67568

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite®555 STAT4 antibody (CL555-67568, Clone: 4A8C9 ) at dilution of 1:200.

• 

  FC experiment of mouse Th1 using CL555-67568

  1X10^6 mouse Th1 cells were intracellularly stained with 0.8 ug CoraLite®555 Anti-Human STAT4 (CL555-67568, Clone:4A8C9) (red), or 0.8 ug Isotype Control. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

STAT4 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL555-67568

Clone No.4A8C9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

IF/ICC, FC (Intra)

Synonyms

SLEB11, DPMC, 4A8C9

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: mouse Th1 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL555-67568 targets STAT4 in IF/ICC, FC (Intra) applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19545

  Product name: Recombinant human STAT4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 399-748 aa of BC031212

  Sequence: FRHLQPKEMKSSAGGKGNEGCHMVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE

• Full Name: signal transducer and activator of transcription 4
• Calculated Molecular Weight: 748 aa, 86 kDa
• Observed Molecular Weight: 86 kDa
• GenBank Accession Number: BC031212
• Gene Symbol: STAT4
• Gene ID (NCBI): 6775
• RRID: AB_2934683
• Conjugate: CoraLite®555 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 557 nm / 570 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14765
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The JAK/STAT pathway is an extensive signaling pathway downstream of cytokine receptors. STATs are cytosolic proteins with a common structure consisting of an N-terminal oligomerization domain, which favors formation of STAT dimers, followed by a DNA-binding domain and a C-terminal SRC homology-2 (SH2) domain, which is involved in association between STATs and receptors[PMID:22383755]. Signal Transducer and Activator of Transcription 4 (STAT4) is a transcription factor that is activated by IL-12 signaling and promotes Th1-cell differentiation and IFN-γ production [PMID:21998209].