CoraLite® Plus 488-conjugated STAT4 Monoclonal antibody

STAT4 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67568
Clone No.4A8C9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

4A8C9, DPMC, SLEB11

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67568 targets STAT4 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19545

Product name: Recombinant human STAT4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 399-748 aa of BC031212

Sequence: FRHLQPKEMKSSAGGKGNEGCHMVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE

Predict reactive species
Full Name signal transducer and activator of transcription 4
Calculated Molecular Weight 748 aa, 86 kDa
Observed Molecular Weight 86 kDa
GenBank Accession NumberBC031212
Gene Symbol STAT4
Gene ID (NCBI) 6775
RRIDAB_2934553
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ14765
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The JAK/STAT pathway is an extensive signaling pathway downstream of cytokine receptors. STATs are cytosolic proteins with a common structure consisting of an N-terminal oligomerization domain, which favors formation of STAT dimers, followed by a DNA-binding domain and a C-terminal SRC homology-2 (SH2) domain, which is involved in association between STATs and receptors[PMID:22383755]. Signal Transducer and Activator of Transcription 4 (STAT4) is a transcription factor that is activated by IL-12 signaling and promotes Th1-cell differentiation and IFN-γ production [PMID:21998209].

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 STAT4 antibody CL488-67568Download protocol
IF protocol for CL Plus 488 STAT4 antibody CL488-67568Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Front Immunol

Stiffness regulates dendritic cell and macrophage subtype development and increased stiffness induces a tumor-associated macrophage phenotype in cancer co-cultures

Authors - Carla Guenther

Cell Metab

Hyperglycemia-triggered lipid peroxidation destabilizes STAT4 and impairs anti-viral Th1 responses in type 2 diabetes

Authors - Victor Gray
Loading...
||
New chat Able
正在加载,请稍候...