CoraLite®594-conjugated STAT5B Monoclonal antibody

STAT5B Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-66427
Clone No.1D9B11

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF/ICC, FC (Intra)

STAT5A/B, STAT5, 1D9B11

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66427 targets STAT5B in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2709

Product name: Recombinant human STAT5B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC020868

Sequence: MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAAT

Predict reactive species
Full Name signal transducer and activator of transcription 5B
Calculated Molecular Weight 787 aa, 90 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC020868
Gene Symbol STAT5B
Gene ID (NCBI) 6777
ENSEMBL Gene IDENSG00000173757
RRIDAB_2934725
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP51692
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

STAT5B belongs to the transcription factor STAT family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT5B carries out a dual function: signal transduction and activation of transcription. STAT5B mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different GH. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. Despite the 95% homology between the immunogen (Ag2709) and the STAT5A protein, our WB detection showed that this antibody does not recognize the STAT5A fusion protein (Ag19546).

Protocols

Product Specific Protocols
IF protocol for CL594 STAT5B antibody CL594-66427Download protocol
FC protocol for CL594 STAT5B antibody CL594-66427Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...