CoraLite® Plus 488-conjugated SULT4A1 Monoclonal antibody

SULT4A1 Monoclonal Antibody for IF-P, FC (Intra)
Cat No. CL488-66106
Clone No.1B9F6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF-P, FC (Intra)

NST, hBR-STL-1, hBR-STL, EC:2.8.2.-, Brain sulfotransferase-like protein

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66106 targets SULT4A1 in IF-P, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17962

Product name: Recombinant human SULT4A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-284 aa of BC022459

Sequence: MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL

Predict reactive species
Full Name sulfotransferase family 4A, member 1
Calculated Molecular Weight 284 aa, 33 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC022459
Gene Symbol SULT4A1
Gene ID (NCBI) 25830
RRIDAB_3672904
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BR01
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SULT4A1, also named as SULTX3, NST, ST4A1, hBR-STL and hBR-STL-1, belongs to the sulfotransferase 1 family. It may catalyze the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. SULT4A1 displays activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphtylamine, and 2-naphtol. It may have a role in the sulfation of drugs and neurotransmitters in the CNS. SULT4A1 is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. It is a novel cytosolic sulfotransferase that is primarily expressed in the brain.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SULT4A1 antibody CL488-66106Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...