CoraLite® Plus 488-conjugated SUMO1 Monoclonal antibody

SUMO1 Monoclonal Antibody for IF/ICC

Cat No. CL488-67559
Clone No.3B5B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

Small ubiquitin related modifier 1, Sentrin, OK/SW-cl.43, GMP1, GAP-modifying protein 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67559 targets SUMO1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29402

Product name: Recombinant human SUMO1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-103 aa of BC006462

Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV

Predict reactive species
Full Name SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae)
Calculated Molecular Weight 12 kDa
Observed Molecular Weight 15-100 kDa
GenBank Accession NumberBC006462
Gene Symbol SUMO1
Gene ID (NCBI) 7341
RRIDAB_3084356
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP63165
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ubiquitin is most famous for its function in targeting proteins for degradation by the 26S proteasome, ubiquitin needs to be attached to a substrate in chains (polyubiquitylation) before being recognized by proteasome. Similarly, SUMO (small ubiquitin-related modifier) can be linked to substrates in chains (polysumoylation), SUMO modification has been implicated in many important cellular processes including the control of genome stability, signal transduction, targeting to and formation of nuclear compartments, cell cycle and meiosis. There are 4 confirmed SUMO isoforms in human, SUMO-1, SUMO-2, SUMO-3 and SUMO-4. SUMO-2 and SUMO-3 are nearly identical but are distinct from SUMO-1. SUMO2/3 conjugation was recently widely involved in neuroprotective activities. A substitution (M55V) of SUMO4 was strongly associated with the pathogenesis of type 1 diabetes (T1D) involving NF kappa B related mechanisms.This antibody can detect endogenous levels of SUMOylated proteins (e.g. SUMO-1-RanGAP at 80-90 kD).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SUMO1 antibody CL488-67559Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...