CoraLite® Plus 488-conjugated SYTL5 Recombinant monoclonal antibody

• 

  IF Staining of rat brain using CL488-85108-5

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using CoraLite® Plus 488 SYTL5 antibody (CL488-85108-5, Clone: 242838D12 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of rat brain using CL488-85108-5

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using CoraLite® Plus 488 SYTL5 antibody (CL488-85108-5, Clone: 242838D12 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SYTL5 Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL488-85108-5

Clone No.242838D12

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IF-P

Synonyms

242838D12, SLP5, synaptotagmin like 5, Synaptotagmin like protein 5, Synaptotagmin-like protein 5

---

Tested Applications

• Positive IF-P detected in: rat brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85108-5 targets SYTL5 in IF-P applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21698

  Product name: Recombinant human SYTL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 56-343 aa of BC131585

  Sequence: TQQEASRVCVHCHRNLGLIFDRGDPCQACSLRVCRECRVAGPNGSWKCTVCDKIAQLRIITGEWFFEEKAKRFKQVNVLGTDVVRQSILRRSPGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRGEIITPKTDTGRSYSLDLDGQHFRSLKSPPGSDRGSTGSSDLNDQEPGPRTPKSSRSNGVTPGTQSSPAPSTRTVTSVISREYGFENSMDLAAIEGTSQELTKSHRRNTSGTPSIAVSGTSLSSDQSRSELDLSESFTEDSEDTVSI

• Full Name: synaptotagmin-like 5
• Calculated Molecular Weight: 730 aa, 81 kDa
• Observed Molecular Weight: 82 kDa
• GenBank Accession Number: BC131585
• Gene Symbol: SYTL5
• Gene ID (NCBI): 94122
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TDW5
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SYTL5, also known as SLP5, is a member of the synaptotagmin-like protein (Slp) family. Members of this family are characterized by the presence of an N-terminal Slp homology domain (SHD), which functions as a Rab27-binding domain, and C-terminal tandem C2 domains, putative Ca(2+)-binding motifs. SYTL5 promotes the development and progression of papillary thyroid carcinoma (PTC) by activating the NF-κB signaling pathway (PMID: 36378561).