• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Spartin/SPG20 Polyclonal antibody

Spartin/SPG20 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-13791

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

SPG20, KIAA0610, SPART, Spartin, SPG 20

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13791 targets Spartin/SPG20 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4815

Product name: Recombinant human Spartin, SPG20 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC047083

Sequence: MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGTGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQHAEVNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAEGHYTVSYGTDSGEFSSVGEEFYRNHSQPPPLETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVPDRSPVLKCTAGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQI

Predict reactive species
Full Name spastic paraplegia 20 (Troyer syndrome)
Calculated Molecular Weight 72 kDa
GenBank Accession NumberBC047083
Gene Symbol Spartin
Gene ID (NCBI) 23111
RRIDAB_2919079
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N0X7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SPG20 (spastic paraplegia 20) gene encodes a multifunctional Spartin protein. SPG20 protein is highly expressed in adipose tissue and may be implicated in endosomal trafficking and microtubule dynamics. SPG20 is mutated in Troyer syndrome, a hereditary spastic paraplegia defined by degeneration of upper motor neurons, recent study showed that regulation of SPG20 on mitochondrial calcium homeostasis may contribute to the pathophysiology of Troyer syndrome. Hypermethylation of SPG20 promoter, found in colorectal cancer patients, may play a role in cytokinesis arrest in colorectal tumorigenesis.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Spartin/SPG20 antibody CL488-13791Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...