TH1L Monoclonal antibody, PBS Only

• 

  WB analysis using 67380-1-Ig (same clone as 67380-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67380-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67380-1-Ig (same clone as 67380-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67380-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67380-1-Ig (same clone as 67380-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67380-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67380-1-Ig (same clone as 67380-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67380-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67380-1-Ig (same clone as 67380-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67380-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 67380-1-Ig (same clone as 67380-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67380-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67380-1-Ig (same clone as 67380-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67380-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67380-1-Ig (same clone as 67380-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 67380-1-Ig (TH1L antibody), at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67380-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67380-1-Ig (same clone as 67380-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using TH1L antibody (67380-1-Ig, Clone: 1A10G2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67380-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67380-1-Ig (same clone as 67380-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TH1L antibody (67380-1-Ig, Clone: 1A10G2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67380-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67380-1-Ig (same clone as 67380-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human TH1L (67380-1-Ig, Clone:1A10G2) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 67380-1-PBS in a different storage buffer formulation.

TH1L Monoclonal Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 67380-1-PBS

Clone No.1A10G2

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

HSPC130, Negative elongation factor C/D, NELF C, NELF C/D, NELF D, NELFD, TH1, TH1 like (Drosophila), TH1 like protein, TH1L

---

Product Information

67380-1-PBS targets TH1L in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24894

  Product name: Recombinant human TH1L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 242-590 aa of BC014952

  Sequence: QAMMSVLAQEEQGGSAVRRIAQEVQRFAQEKGHDASQITLALGTAASYPRACQALGAMLSKGALNPADITVLFKMFTSMDPPPVELIRVPAFLDLFMQSLFKPGARINQDHKHKYIHILAYAASVVETWKKNKRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCHQLLHPQVLQLLVKLFETEHSQLDVMEQLELKKTLLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPYTSDFVQLFLPILENDSIAGTIKTEGEHDPVTEFIAHCKSNFIMVN

• Full Name: TH1-like (Drosophila)
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 60-66 kDa
• GenBank Accession Number: BC014952
• Gene Symbol: TH1L
• Gene ID (NCBI): 51497
• RRID: AB_2882627
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IXH7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.