×
Use Able AI chat for product recommendations

TH1L Monoclonal antibody

TH1L Monoclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 67380-1-Ig
Clone No. 1A10G2
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat and More (1)

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

HSPC130, Negative elongation factor C/D, NELF C, NELF C/D, NELF D, NELFD, TH1, TH1 like (Drosophila), TH1 like protein, TH1L

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of various lysates using TH1L Monoclonal antibody (67380-1-Ig)

    WB analysis using 67380-1-Ig

    Various lysates were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of Jurkat cells using TH1L Monoclonal antibody (67380-1-Ig)

    WB analysis of Jurkat using 67380-1-Ig

    Jurkat cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of K-562 cells using TH1L Monoclonal antibody (67380-1-Ig)

    WB analysis of K-562 using 67380-1-Ig

    K-562 cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HSC-T6 cells using TH1L Monoclonal antibody (67380-1-Ig)

    WB analysis of HSC-T6 using 67380-1-Ig

    HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of NIH/3T3 cells using TH1L Monoclonal antibody (67380-1-Ig)

    WB analysis of NIH/3T3 using 67380-1-Ig

    NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of RAW 264.7 cells using TH1L Monoclonal antibody (67380-1-Ig)

    WB analysis of RAW 264.7 using 67380-1-Ig

    RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of Jurkat cells using TH1L Monoclonal antibody (67380-1-Ig)

    WB analysis of Jurkat using 67380-1-Ig

    Jurkat cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using TH1L Monoclonal antibody (67380-1-Ig)

    IF Staining of HeLa using 67380-1-Ig

    Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 67380-1-Ig (TH1L antibody), at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using TH1L Monoclonal antibody (67380-1-Ig)

    IF Staining of HeLa using 67380-1-Ig

    Immunofluorescent analysis of (4% PFA) fixed HeLa cells using TH1L antibody (67380-1-Ig, Clone: 1A10G2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using TH1L Monoclonal antibody (67380-1-Ig)

    IF Staining of HeLa using 67380-1-Ig

    Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TH1L antibody (67380-1-Ig, Clone: 1A10G2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Flow cytometry (FC) experiment of HeLa cells using TH1L Monoclonal antibody (67380-1-Ig)

    FC experiment of HeLa using 67380-1-Ig

    1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human TH1L (67380-1-Ig, Clone:1A10G2) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Able AI
Able AI
What's the best dilution for TH1L in ?

Tested Applications

Positive WB detected inA549 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells, MCF-7 cells, HeLa cells, HepG2 cells
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67380-1-Ig targets TH1L in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24894

Product name: Recombinant human TH1L protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 242-590 aa of BC014952

Sequence: QAMMSVLAQEEQGGSAVRRIAQEVQRFAQEKGHDASQITLALGTAASYPRACQALGAMLSKGALNPADITVLFKMFTSMDPPPVELIRVPAFLDLFMQSLFKPGARINQDHKHKYIHILAYAASVVETWKKNKRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCHQLLHPQVLQLLVKLFETEHSQLDVMEQLELKKTLLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPYTSDFVQLFLPILENDSIAGTIKTEGEHDPVTEFIAHCKSNFIMVN

Predict reactive species
Full Name TH1-like (Drosophila)
Calculated Molecular Weight 66 kDa
Observed Molecular Weight 60-66 kDa
GenBank Accession NumberBC014952
Gene Symbol TH1L
Gene ID (NCBI) 51497
RRIDAB_2882627
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8IXH7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
FC protocol for TH1L antibody 67380-1-IgDownload protocol
IF protocol for TH1L antibody 67380-1-IgDownload protocol
WB protocol for TH1L antibody 67380-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The TH1L Monoclonal antibody (1A10G2), catalog number 67380-1-Ig, has 1 total citation. It appears in the British Journal of Cancer (IF 7.8), in a study investigating how eIF3i facilitates NELFCD translation to promote cancer metastasis through EMT regulation and invadopodia formation. The cited application is Western blot in human samples, with RNAi validation.

Automatically generated from the 1 publication citations by Able AI.
SpeciesApplicationTitle
humanWB

Br J Cancer

eIF3i facilitates NELFCD translation to promote metastasis via regulating EMT and invadopodia.

Authors - Qing Huang
  • KD Validated
View Article
||
New chat

Able™

正在加载，请稍候...