TIP30 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TIP30 Polyclonal antibody, PBS Only (10251-1-PBS)

• 

  WB analysis using 10251-1-AP (same clone as 10251-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10251-1-AP (TIP30 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10251-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SW 1990 using 10251-1-AP (same clone as 10251-1-PBS)

  SW 1990 cells were subjected to SDS PAGE followed by western blot with 10251-1-AP (TIP30 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10251-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 10251-1-AP (same clone as 10251-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10251-1-AP (TIP30 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 10251-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 10251-1-AP (same clone as 10251-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10251-1-AP (TIP30 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 10251-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 10251-1-AP (same clone as 10251-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10251-1-AP (TIP30 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10251-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 10251-1-AP (same clone as 10251-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10251-1-AP (TIP30 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10251-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10251-1-AP (same clone as 10251-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TIP30 antibody (10251-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 10251-1-PBS in a different storage buffer formulation.

TIP30 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10251-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

HTATIP2, 30 kDa HIV-1 TAT-interacting protein, CC3, EC:1.1.1.-, HIV-1 TAT-interactive protein 2

---

Product Information

10251-1-PBS targets TIP30 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0353

  Product name: Recombinant human TIP30 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 82-276 aa of BC002439

  Sequence: TLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP

• Full Name: HIV-1 Tat interactive protein 2, 30kDa
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC002439
• Gene Symbol: TIP30
• Gene ID (NCBI): 10553
• RRID: AB_2279817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUP3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TIP30/CC3 was first identified and characterized as a "candidate" tumor-suppressor gene in 1997. TIP30 is involved in the control of cell apoptosis, growth, metastasis, angiogenesis, DNA repair, and tumor cell metabolism.