CoraLite®594 Anti-Human TNF beta Rabbit Recombinant Antibody

TNF beta Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. CL594-98056
Clone No.240393C3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

LTA, 240393C3, LT alpha, Lymphotoxin alpha, Lymphotoxin-alpha

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inAnti-CD3/CD28 treated human PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-98056 targets TNF beta in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0836

Product name: Recombinant Human TNF-beta protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 35-205 aa of BC034729

Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Predict reactive species
Full Name lymphotoxin alpha (TNF superfamily, member 1)
Calculated Molecular Weight 205 aa, 22 kDa
GenBank Accession NumberBC034729
Gene Symbol TNF beta
Gene ID (NCBI) 4049
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01374
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

TNF beta also known as lymphotoxin alpha (LTA), is a member of the tumor necrosis factor family, and is a cytokine produced by lymphocytes. TNF Beta is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. TNF Beta also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis.

Protocols

Product Specific Protocols
FC protocol for CL594 TNF beta antibody CL594-98056Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...