Use Able AI chat for product recommendations
  • Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® PerCP-Cyanine5.5 Anti-Human TNF beta Rabbit Recombinant Antibody

TNF beta FcZero-rAb® Recombinant Antibody for FC (Intra)

Cat No. CPY5-FcA98056
Clone No.240393C3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

LTA, LT alpha, Lymphotoxin alpha, Lymphotoxin-alpha, TNF β

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inAnti-CD3/CD28 treated human PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CPY5-FcA98056 targets TNF beta in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0836

Product name: Recombinant Human TNF-beta protein (His Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 35-205 aa of BC034729

Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Predict reactive species
Full Name lymphotoxin alpha (TNF superfamily, member 1)
Calculated Molecular Weight 205 aa, 22 kDa
GenBank Accession NumberBC034729
Gene Symbol TNF beta
Gene ID (NCBI) 4049
RRIDAB_3749230
Conjugate PerCP-Cyanine5.5 Fluorescent Dye
Excitation/Emission Maxima Wavelengths482 nm / 690nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01374
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

TNF beta also known as lymphotoxin alpha (LTA), is a member of the tumor necrosis factor family, and is a cytokine produced by lymphocytes. TNF Beta is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. TNF Beta also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis.

Protocols

Product Specific Protocols
FC protocol for PerCP-Cyanine5.5 TNF beta antibody CPY5-FcA98056Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...