CoraLite® Plus 488-conjugated TOE1 Monoclonal antibody

TOE1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67829
Clone No.2C10H7

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF/ICC, FC (Intra)

2C10H7

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67829 targets TOE1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28982

Product name: Recombinant human TOE1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-262 aa of BC009364

Sequence: MAADSDDGAVSAPAASDGGVSKSTTSGEELVVQVPVVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERYKAVCHAARTRSILSLGLACFKRQPDKGEHSYLAQVFNLTLLCMEEYVIEPKSVQFLIQHGFNFNQQYAQGIPYHKGNDKGDESQSQSVRTLFLELIRARRPLVLHNGLIDLVFLYQNFYAHLPESLGTFTADLCEMFPAGIYDTKYAAEFHARFVASYLEYAFRKCERENGKQRAAG

Predict reactive species
Full Name target of EGR1, member 1 (nuclear)
Calculated Molecular Weight 510 aa, 57 kDa
Observed Molecular Weight57 kDa
GenBank Accession NumberBC009364
Gene Symbol TOE1
Gene ID (NCBI) 114034
RRIDAB_2923796
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96GM8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TOE1, also known as hCaf1z, belongs to the DEDD family of deadenylases. TOE1 was initially identified as a direct target gene of ERG1, an immediate early transcription factor. TOE1 encodes an Asp-Glu-Asp-Asp deadenylase that specifically localizes to Cajal bodies in the nucleus, where assembly and maturation of small nuclear ribonucleoprotein particles, and telomerase ribonucleoprotein complex take place (PMID: 36257135). TOE1 has 2 isoforms with the molecular mass of 48 and 57 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 TOE1 antibody CL488-67829Download protocol
IF protocol for CL Plus 488 TOE1 antibody CL488-67829Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...