TRAK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRAK2 Polyclonal antibody, PBS Only (13770-1-PBS)

• 

  WB analysis of human liver using 13770-1-AP (same clone as 13770-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 13770-1-AP (TRAK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13770-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 13770-1-AP (same clone as 13770-1-PBS)

  IP result of anti-TRAK2 (IP:13770-1-AP, 4ug; Detection:13770-1-AP 1:500) with HepG2 cells lysate 4000ug. This data was developed using the same antibody clone with 13770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 13770-1-AP (same clone as 13770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 13770-1-AP (TRAK2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13770-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 13770-1-AP (same clone as 13770-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 13770-1-AP (TRAK2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13770-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13770-1-AP (same clone as 13770-1-PBS)

  Immunofluorescent analysis of Hela cells, using TRAK2 antibody 13770-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 13770-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13770-1-AP (same clone as 13770-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TRAK2 antibody (13770-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13770-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13770-1-AP (same clone as 13770-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 13770-1-AP (TRAK2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13770-1-PBS in a different storage buffer formulation.

TRAK2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 13770-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Trafficking kinesin-binding protein 2, KIAA0549, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 3 protein, ALS2CR3

---

Product Information

13770-1-PBS targets TRAK2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4753

  Product name: Recombinant human TRAK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-354 aa of BC040668

  Sequence: MSQSQNAIFTSPTGEENLMNSNHRDSESITDVCSNEDLPEVELVSLLEEQLPQYRLKVDTLFLYENQDWTQSPHQRQHASDALSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLAERDRDLELAARIGQALLKRNHILSEQNESLEEQLGQAFDQVNQLQHELCKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQLEMLQEKLKELEEENMALRSKACHIKTETVTYEEKEQQLVSDCVKELRETNAQMSRMTEELSGKSDELVRYQEELSSLLSQIVDLQHKLKEHVIEKEELKLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRSRS

• Full Name: trafficking protein, kinesin binding 2
• Calculated Molecular Weight: 914 aa, 101 kDa
• Observed Molecular Weight: 101-106 kDa
• GenBank Accession Number: BC040668
• Gene Symbol: TRAK2
• Gene ID (NCBI): 66008
• RRID: AB_2207961
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60296
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Trafficking kinesin-binding protein 2 (TRAK2) is a member of the TRAK family of kinesin adaptor proteins. In mammals, there are two members of the TRAK family, TRAK1 and TRAK2 (PMID: 25653102). TRAK1 and TRAK2 play roles in lysosomal and mitochondrial trafficking in cells. They function as kinesin adaptors linking kinesin heavy chain (KHC) to mitochondria (PMID: 28364549). TRAK2 has been found to act as a trafficking factor for the K+ channel Kir2.1 and γ-Aminobutyric acid type A (GABAA) receptor (PMID: 16895905; 24122114).