UACA Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UACA Polyclonal antibody, PBS Only (25654-1-PBS)

• 

  WB analysis using 25654-1-AP (same clone as 25654-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25654-1-AP (UACA antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25654-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Neuro-2a using 25654-1-AP (same clone as 25654-1-PBS)

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 25654-1-AP (UACA Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25654-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 25654-1-AP (same clone as 25654-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25654-1-AP (UACA Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25654-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Y79 using 25654-1-AP (same clone as 25654-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 25654-1-AP (UACA Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25654-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 25654-1-AP (same clone as 25654-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 25654-1-AP (UACA antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 25654-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 25654-1-AP (same clone as 25654-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 25654-1-AP (UACA antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 25654-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 25654-1-AP (same clone as 25654-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 25654-1-AP (UACA antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 25654-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 25654-1-AP (same clone as 25654-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 25654-1-AP (UACA antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 25654-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A375 using 25654-1-AP (same clone as 25654-1-PBS)

  Immunofluorescent analysis of A375 cells using 25654-1-AP (UACA antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25654-1-PBS in a different storage buffer formulation.

UACA Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 25654-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

KIAA1561, NUCLING, Uveal autoantigen with coiled-coil domains and ankyrin repeats

---

Product Information

25654-1-PBS targets UACA in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22438

  Product name: Recombinant human UACA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1075-1416 aa of BC113407

  Sequence: LSQKYTEVKNVKEKLVEENAKQTSEILAVQNLLQKQHVPLEQVEALKKSLNGTIENLKEELKSMQRCYEKEQQTVTKLHQLLENQKNSSVPLAEHLQIKEAFEKEVGIIKASLREKEEESQNKMEEVSKLQSEVQNTKQALKKLETREVVDLSKYKATKSDLETQISSLNEKLANLNRKYEEVCEEVLHAKKKEISAKDEKELLHFSIEQEIKDQKERCDKSLTTITELQRRIQESAKQIEAKDNKITELLNDVERLKQALNGLSQLTYTSGNPTKRQSQLIDTLQHQVKSLEQQLADADRQHQEVIAIYRTHLLSAAQGHMDEDVQEALLQIIQMRQGLVC

• Full Name: uveal autoantigen with coiled-coil domains and ankyrin repeats
• Calculated Molecular Weight: 1416 aa, 163 kDa
• Observed Molecular Weight: 163 kDa
• GenBank Accession Number: BC113407
• Gene Symbol: UACA
• Gene ID (NCBI): 55075
• RRID: AB_2880179
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZF9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.