USP29 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• USP29 Polyclonal antibody, PBS Only (27522-1-PBS)

• 

  WB analysis using 27522-1-AP (same clone as 27522-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27522-1-AP (USP29 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27522-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 27522-1-AP (same clone as 27522-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 27522-1-AP (USP29 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27522-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 27522-1-AP (same clone as 27522-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27522-1-AP (USP29 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27522-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 27522-1-AP (same clone as 27522-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27522-1-AP (USP29 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27522-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

USP29 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27522-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Deubiquitinating enzyme 29, EC:3.4.19.12, HOM TES 84/86, Ubiquitin carboxyl-terminal hydrolase 29, Ubiquitin thioesterase 29

---

Product Information

27522-1-PBS targets USP29 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23231

  Product name: Recombinant human USP29 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-285 aa of BC130394

  Sequence: MISLKVCGFIQIWSQKTGMTKLKEALIETVQRQKEIKLVVTFKSGKFIRIFQLSNNIRSVVLRHCKKRQSHLRLTLKNNVFLFIDKLSYRDAKQLNMFLDIIHQNKSQQPMKSDDDWSVFESRNMLKEIDKTSFYSICNKPSYQKMPLFMSKSPTHVKKGILENQGGKGQNTLSSDVQTNEDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDETVLATQTLNAKNGLTSPLEPEHSQGDPRCNKAQVPLDSHSQQLQQ

• Full Name: ubiquitin specific peptidase 29
• Observed Molecular Weight: 104 kDa
• GenBank Accession Number: BC130394
• Gene Symbol: USP29
• Gene ID (NCBI): 57663
• RRID: AB_2880898
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HBJ7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.