CoraLite® Plus 647-conjugated VE-cadherin/CD144 Monoclonal antibody

VE-cadherin/CD144 Monoclonal Antibody for IF/ICC
Cat No. CL647-66804
Clone No.4F9B10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC

VE-cadherin, 4F9B10, 7B4, 7B4 antigen, Cadherin 5

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHUVEC cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-66804 targets VE-cadherin/CD144 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27501

Product name: Recombinant human CDH5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 54-241 aa of NM_001795

Sequence: MHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSGT

Predict reactive species
Full Name cadherin 5, type 2 (vascular endothelium)
Calculated Molecular Weight 88 kDa
Observed Molecular Weight125 kDa, 100 kDa
GenBank Accession NumberNM_001795
Gene Symbol VE-cadherin
Gene ID (NCBI) 1003
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP33151
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. Vascular endothelial cadherin (VE-cadherin), also known as Cadherin-5 (CDH5) or CD144, is a member of the type II classical cadherin family of cell adhesion proteins (PMID: 21269602). VE-cadherin is expressed specifically in endothelial cells and mediates homophilic adhesion in the vascular endothelium (PMID: 1522121; 8555485; 21269602). VE-cadherin plays a role in the organization of lateral endothelial junctions and in the control of permeability properties of vascular endothelium (PMID: 1522121). VE-cadherin has also been shown to be required for angiogenesis (PMID: 16473763; 18162609).

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 VE-cadherin/CD144 antibody CL647-66804Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...