CoraLite® Plus 488-conjugated ZFP36L1 Monoclonal antibody

ZFP36L1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-68038
Clone No.1H6G6

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat

Applications

IF/ICC, FC (Intra)

ZFP36L1/2, 1H6G6, EGF-response factor 1, ERF-1, mRNA decay activator protein ZFP36L1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68038 targets ZFP36L1 in IF/ICC, FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30469

Product name: Recombinant human ZFP36L1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-338 aa of BC018340

Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD

Predict reactive species
Full Name zinc finger protein 36, C3H type-like 1
Calculated Molecular Weight 338 aa, 36 kDa
Observed Molecular Weight36 kDa
GenBank Accession NumberBC018340
Gene Symbol ZFP36L1
Gene ID (NCBI) 677
RRIDAB_3084392
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ07352
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

As a member of the Tristetraprolin (TTP) RNA binding protein family, ZFP36L1 regulate gene expression post-transcriptionally by promoting mRNA decay. In mammals, ZFP36L1 and its family members have been shown to regulate development, cell diferentiation, cell cycle, apoptosis and anti-cancer capability by targeting an extensive overlapping repertoire of mRNAs.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 ZFP36L1 antibody CL488-68038Download protocol
IF protocol for CL Plus 488 ZFP36L1 antibody CL488-68038Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...