Featured Product
KD/KO Validated

Ki-67 Polyclonal antibody

Ki67 antibodies are widely used as markers for cell proliferation, enabling the detection and quantification of actively dividing cells in tissue samples for research and diagnostic applications, especially in cancer pathology. Proteintech has an extensive range of Ki-67 antibodies validated for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA, Cell treatment and more.

Cat No. 27309-1-AP

Publications(1915)

Reviews (8)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

IHC, IF/ICC, IF-P, FC (Intra), ELISA

Synonyms

KI67, MKI67, Antigen identified by monoclonal antibody Ki-67, Antigen KI-67, Ki 67

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite®555 CoraLite®594

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHCIF-PIF/ICCFC (Intra)

IHC staining of human tonsillitis using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 27309-1-AP (Ki-67 antibody) at dilution of 1:8000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 27309-1-AP (Ki-67 antibody) at dilution of 1:8000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of K-562 using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded k562 slide using 27309-1-AP (KI67 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27309-1-AP (KI67 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27309-1-AP (KI67 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human gliomas using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 27309-1-AP (KI67 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human gliomas using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 27309-1-AP (KI67 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27309-1-AP (KI67 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27309-1-AP (KI67 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27309-1-AP (KI67 antibody) at dilution of 1:16000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27309-1-AP (KI67 antibody) at dilution of 1:16000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skin cancer using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 27309-1-AP (KI67 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skin cancer using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 27309-1-AP (KI67 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 27309-1-AP (KI67 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 27309-1-AP (KI67 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27309-1-AP (KI67 antibody) at dilution of 1:16000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27309-1-AP (KI67 antibody) at dilution of 1:16000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of Insulinoma using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded Insulinoma tissue slide using 27309-1-AP (KI67 antibody) at dilution of 1:16000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of Insulinoma using 27309-1-AP
Immunohistochemical analysis of paraffin-embedded Insulinoma tissue slide using 27309-1-AP (KI67 antibody) at dilution of 1:16000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human lung cancer using 27309-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung cancer tissue using Ki-67 antibody (27309-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human lung cancer using 27309-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung cancer tissue using Ki-67 antibody (27309-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human tonsillitis using 27309-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using Ki-67 antibody (27309-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human tonsillitis using 27309-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using Ki-67 antibody (27309-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 27309-1-AP
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using KI67 antibody (27309-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 27309-1-AP
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 27309-1-AP (KI67 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). F-actin is stained using CL555-phalloidin (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HEK-293 using 27309-1-AP
Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using KI67 antibody (27309-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 27309-1-AP
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using KI67 antibody (27309-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of Jurkat using 27309-1-AP
1X10^6 Jurkat cells were intracellularly stained with 0.4 ug Anti-Human KI67 (27309-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug x. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (1915)
Protocols
Reviews (8)

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in	human tonsillitis tissue, human colon cancer tissue, human gliomas tissue, human lung cancer tissue, human skin cancer tissue, human lymphoma tissue, human breast cancer tissue, Insulinoma tissue, K-562 cells **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	human tonsillitis tissue, human lung cancer tissue
Positive IF/ICC detected in	HeLa cells, HEK-293 cells
Positive FC (Intra) detected in	Jurkat cells

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:4000-1:16000
Immunofluorescence (IF)-P	IF-P : 1:200-1:800
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27309-1-AP targets Ki-67 in IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human, rabbit, sheep
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26266 Product name: Recombinant human KI67 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1201-1300 aa of NM_002417 Sequence: AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK Predict reactive species
Full Name	antigen identified by monoclonal antibody Ki-67
Calculated Molecular Weight	359 kDa
GenBank Accession Number	NM_002417
Gene Symbol	KI67
Gene ID (NCBI)	4288
RRID	AB_2756525
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P46013
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry. It has been demonstrated to be of prognostic value in breast cancer. In head and neck cancer, several studies have reported an association between high proliferative activity and poorer prognosis.

Protocols

Product Specific Protocols
FC protocol for Ki-67 antibody 27309-1-AP	Download protocol
IF protocol for Ki-67 antibody 27309-1-AP	Download protocol
IHC protocol for Ki-67 antibody 27309-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	IHC	Signal Transduct Target Ther Exosomes secreted from cardiomyocytes suppress the sensitivity of tumor ferroptosis in ischemic heart failure Authors - Ye Yuan View Article
	IHC	Signal Transduct Target Ther FBXW7β loss-of-function enhances FASN-mediated lipogenesis and promotes colorectal cancer growth Authors - Wenxia Wei View Article
pig		Nature Gene-modified pig-to-human liver xenotransplantation Authors - Kai-Shan Tao View Article
human	IHC	Cancer Cell Proteogenomic characterization of non-functional pancreatic neuroendocrine tumors unravels clinically relevant subgroups Authors - Shunrong Ji View Article
human	IHC	Cancer Cell Epithelial cells activate fibroblasts to promote esophageal cancer development Authors - Yamei Chen View Article
human	IF	J Hematol Oncol Regulation of Hippo-YAP signaling by insulin-like growth factor-1 receptor in the tumorigenesis of diffuse large B-cell lymphoma. Authors - Xiangxiang Zhou View Article

Reviews

4.8 out of 5

Add a review

8 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Ahmad (Verified Customer) (07-02-2026)	Works wel Applications: Immunofluorescence Primary Antibody Dilution: 1/200
Udesh (Verified Customer) (08-12-2025)	Worked well in Western, also detected a non specific band at 70 kDa Applications: Western Blot Primary Antibody Dilution: 1:5000 Cell Tissue Type: MSCs
Celine (Verified Customer) (07-09-2025)	Works well in immunoflurescence with fixed cells Applications: Immunofluorescence Primary Antibody Dilution: 1:500 O/N Cell Tissue Type: glioblastoma cell lines Ki-67 Antibody Immunofluorescence validation (1:500 O/N dilution) in glioblastoma cell lines (Cat no:27309-1-AP)
Guo-rong (Verified Customer) (08-30-2022)	Clear staining Applications: Immunofluorescence Primary Antibody Dilution: 1:200 Cell Tissue Type: ARPE-19 Ki-67 Antibody Immunofluorescence validation (1:200 dilution) in ARPE-19 (Cat no:27309-1-AP)
Alessandro (Verified Customer) (07-27-2022)	No aspecific staining, great outcome Applications: Immunofluorescence Primary Antibody Dilution: 1:250 Cell Tissue Type: ARPE-19
Ana (Verified Customer) (02-15-2022)	Both, 1:50 and 1:100 dilutions worked well Applications: Immunofluorescence Primary Antibody Dilution: 1:50, 1:100 Cell Tissue Type: ARPE-19
kes (Verified Customer) (01-17-2022)	Works at 1:200 dilution for IHC Applications: Immunohistochemistry Primary Antibody Dilution: 1:200 Cell Tissue Type: murine tissues
Yan (Verified Customer) (02-18-2020)	1:100 work for cell. Applications: Immunofluorescence,