Filter:
  • Western Blot (WB) analysis of various lysates using Gamma Tubulin Monoclonal antibody (66320-1-Ig)

    WB analysis using 66320-1-Ig

    Various lysates were subjected to SDS PAGE followed by western blot with 66320-1-Ig (gamma tubulin antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of K-562 cells using Gamma Tubulin Monoclonal antibody (66320-1-Ig)

    WB analysis of K-562 using 66320-1-Ig

    K-562 cells were subjected to SDS PAGE followed by western blot with 66320-1-Ig (gamma tubulin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of HepG2 cells using Gamma Tubulin Monoclonal antibody (66320-1-Ig)

    WB analysis of HepG2 using 66320-1-Ig

    HepG2 cells were subjected to SDS PAGE followed by western blot with 66320-1-Ig (gamma tubulin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of EC109 cells using Gamma Tubulin Monoclonal antibody (66320-1-Ig)

    WB analysis of EC109 using 66320-1-Ig

    EC109 cells were subjected to SDS PAGE followed by western blot with 66320-1-Ig (gamma tubulin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Immunohistochemistry (IHC) staining of human breast cancer tissue using Gamma Tubulin Monoclonal antibody (66320-1-Ig)

    IHC staining of human breast cancer using 66320-1-Ig

    Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66320-1-Ig (gamma tubulin antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human breast cancer tissue using Gamma Tubulin Monoclonal antibody (66320-1-Ig)

    IHC staining of human breast cancer using 66320-1-Ig

    Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66320-1-Ig (gamma tubulin antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using Gamma Tubulin Monoclonal antibody (66320-1-Ig)

    IHC staining of human prostate cancer using 66320-1-Ig

    Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66320-1-Ig (gamma tubulin antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using Gamma Tubulin Monoclonal antibody (66320-1-Ig)

    IHC staining of human prostate cancer using 66320-1-Ig

    Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66320-1-Ig (gamma tubulin antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of MDCK cells using Gamma Tubulin Monoclonal antibody (66320-1-Ig)

    IF Staining of MDCK using 66320-1-Ig

    Immunofluorescent analysis of (-20°C Ethanol) fixed MDCK cells using 66320-1-Ig (gamma tubulin antibody) at dilution of 1:200 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  • Immunofluorescence (IF) / fluorescent staining of MDCK cells using Gamma Tubulin Monoclonal antibody (66320-1-Ig)

    IF Staining of MDCK using 66320-1-Ig

    Immunofluorescent analysis of (-20°C Ethanol) fixed MDCK cells using 66320-1-Ig (gamma tubulin antibody) at dilution of 1:200 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  • Immunofluorescence (IF) / fluorescent staining of A549 cells using Gamma Tubulin Monoclonal antibody (66320-1-Ig)

    IF Staining of A549 using 66320-1-Ig

    Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using Gamma Tubulin antibody (66320-1-Ig, Clone: 3F9H8 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), Alpha Tubulin antibody (11224-1-AP, red).

  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using Gamma Tubulin Monoclonal antibody (66320-1-Ig)

    IF Staining of HeLa using 66320-1-Ig

    Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 66320-1-Ig (gamma tubulin antibody) at dilution of 1:100 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  • Flow cytometry (FC) experiment of HeLa cells using Gamma Tubulin Monoclonal antibody (66320-1-Ig)

    FC experiment of HeLa using 66320-1-Ig

    1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human Gamma Tubulin (66320-1-Ig, Clone:3F9H8) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

"Gamma Tubulin Antibodies" Comparison

View side-by-side comparison of Gamma Tubulin antibodies from other vendors to find the one that best suits your research needs.

Gamma Tubulin Monoclonal antibody

This Gamma Tubulin antibody is a mouse monoclonal antibody that targets Gamma Tubulin in WB, IHC, IF/ICC, FC (Intra), ELISA and is suitable for human, mouse, rat, canine samples.
Cat No. 66320-1-Ig
Clone No.3F9H8

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, canine

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

TUBG1, 3F9H8, Gamma-1-tubulin, Gamma-tubulin complex component 1, GCP-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNCCIT cells, HepG2 cells, EC109 cells, K-562 cells, HSCT6 cells, NIH3T3 cells
Positive IHC detected inhuman breast cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMDCK cells, HeLa cells, A549 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:200-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66320-1-Ig targets Gamma Tubulin in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, canine samples.

Tested Reactivity human, mouse, rat, canine
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23913

Product name: Recombinant human tubulin-gamma protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 150-451 aa of BC000619

Sequence: GSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ

Predict reactive species
Full Name tubulin, gamma 1
Calculated Molecular Weight 51 kDa
Observed Molecular Weight 48-55 kDa
GenBank Accession NumberBC000619
Gene Symbol Gamma Tubulin
Gene ID (NCBI) 7283
RRIDAB_2857350
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP23258
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Gamma tubulin is a member of tubulin superfamily and is a key component required for microtubule nucleation and stabilization. It is concentrated at the pericentriolar material of centrosomes in interphase cells, predominantly on spindle poles in mitotic cells, while found in midbodies during cytokinesis. Overexpression of gamma tubulin has been found in various cancers including breast cancer and gliomas. This antibody can well label the centrosome structure.

Protocols

Product Specific Protocols
FC protocol for Gamma Tubulin antibody 66320-1-IgDownload protocol
IF protocol for Gamma Tubulin antibody 66320-1-IgDownload protocol
IHC protocol for Gamma Tubulin antibody 66320-1-IgDownload protocol
WB protocol for Gamma Tubulin antibody 66320-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nature

Structure of LRRK2 in Parkinson's disease and model for microtubule interaction.

Authors - C K Deniston
IF

EMBO Mol Med

Mutations in GRK2 cause Jeune syndrome by impairing Hedgehog and canonical Wnt signaling.

Authors - Michaela Bosakova
mouseWB

J Cell Biol

Time-resolved proteomics profiling of the ciliary Hedgehog response.

Authors - Elena A May
IF

Cell Rep

MYO10 regulates genome stability and cancer inflammation through mediating mitosis

Authors - Franklin Mayca Pozo
humanIF

Elife

Respiratory syncytial virus co-opts host mitochondrial function to favour infectious virus production.

Authors - MengJie Hu
humanWB,IF

J Nanobiotechnology

GRP75-driven, cell-cycle-dependent macropinocytosis of Tat/pDNA-Ca2+ nanoparticles underlies distinct gene therapy effect in ovarian cancer.

Authors - Linjia Su

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lola (Verified Customer) (10-23-2025)

This antibody works well. Suitable for immunofluorescence and expansion microscopy. We use cold MeOH fixation.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Primary myoblasts
Gamma Tubulin Antibody Immunofluorescence validation (1:200 dilution) in Primary myoblasts (Cat no:66320-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...