• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated EIF4E Monoclonal antibody

EIF4E Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-66655
Clone No.3C6B9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

3C6B9, eIF 4E, eIF-4E, EIF4EL1, EIF4F

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66655 targets EIF4E in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27191

Product name: Recombinant human EIF4E protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-217 aa of BC012611

Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLNRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV

Predict reactive species
Full Name eukaryotic translation initiation factor 4E
Calculated Molecular Weight 29 kDa
Observed Molecular Weight 25 kDa
GenBank Accession NumberBC012611
Gene Symbol EIF4E
Gene ID (NCBI) 1977
RRIDAB_2883611
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP06730
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Eukaryotic translation initiation factor 4E(EIF4E) is the rate-limiting part of mRNA 7-methyl guanosine cap-binding component of the translation initiation complex eIF4F. The other subunits of EIF4F are a 50-kD polopeptied, terned EIF4A and a 220-kD polypeptied EIF4G. EIF4E mediates the binding to the mRNA cap then repress the translation. Due to the increasing expression of c-Myc in the oncogene, EIF4E's activity is enhance.

Protocols

Product Specific Protocols
FC protocol for CL594 EIF4E antibody CL594-66655Download protocol
IF protocol for CL594 EIF4E antibody CL594-66655Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...